Return to main results Retrieve Phyre Job Id

Job DescriptionP03856
Confidence20.05%DateThu Jan 5 10:58:05 GMT 2012
Rank52Aligned Residues45
% Identity11%Templatec3qp5C_
PDB info PDB header:transcriptionChain: C: PDB Molecule:cvir transcriptional regulator; PDBTitle: crystal structure of cvir bound to antagonist chlorolactone (cl)
Resolution3.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2930.........40.........50.........60.........70.........80.........
Predicted Secondary structure 



















Query SS confidence 




























































Query Sequence  YSLSRDQKRMLYLFVDQIRKSDGTLQEHDGICEIHVAKYAEIFGLTSAEASKDIRQALKSF
Query Conservation    

  
 


   
  
               
   

           
  

     
Alig confidence 

















................


























Template Conservation    

 

 


   
 
 ................
  


  
 

  

  

  
  

Template Sequence  NLLSQREYDIFHWMSRGK. . . . . . . . . . . . . . . . TNWEIATILDISERTVKFHVANVIRKL
Template Known Secondary structure 



TTT
................
T

Template Predicted Secondary structure 






................




Template SS confidence 




























































   187..190.........200.... .....210.........220.........230.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions