Return to main results Retrieve Phyre Job Id

Job DescriptionP03856
Confidence45.45%DateThu Jan 5 10:58:05 GMT 2012
Rank19Aligned Residues45
% Identity16%Templatec1zljE_
PDB info PDB header:transcriptionChain: E: PDB Molecule:dormancy survival regulator; PDBTitle: crystal structure of the mycobacterium tuberculosis hypoxic2 response regulator dosr c-terminal domain
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   30.........40.........50.........60.........70.........80.........90
Predicted Secondary structure 


















Query SS confidence 




























































Query Sequence  SLSRDQKRMLYLFVDQIRKSDGTLQEHDGICEIHVAKYAEIFGLTSAEASKDIRQALKSFA
Query Conservation   

  
 


   
  
               
   

           
  

     
 
Alig confidence 
















................



























Template Conservation   

 

  

   
 
 ................
  


  
 

  

      
  

 
Template Sequence  GLTDQERTLLGLLSEGL. . . . . . . . . . . . . . . . TNKQIADRXFLAEKTVKNYVSRLLAKLG
Template Known Secondary structure  S

TTT
................
T

T
Template Predicted Secondary structure 




................




Template SS confidence 




























































   149150.........160..... ....170.........180.........190...
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions