Return to main results Retrieve Phyre Job Id

Job DescriptionP03856
Confidence14.11%DateThu Jan 5 10:58:05 GMT 2012
Rank64Aligned Residues44
% Identity20%Templatec1h0mD_
PDB info PDB header:transcription/dnaChain: D: PDB Molecule:transcriptional activator protein trar; PDBTitle: three-dimensional structure of the quorum sensing protein2 trar bound to its autoinducer and to its target dna
Resolution3.0 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   30.........40.........50.........60.........70.........80.........
Predicted Secondary structure 


















Query SS confidence 



























































Query Sequence  SLSRDQKRMLYLFVDQIRKSDGTLQEHDGICEIHVAKYAEIFGLTSAEASKDIRQALKSF
Query Conservation   

  
 


   
  
               
   

           
  

     
Alig confidence 
















................


























Template Conservation   

 

 


 


 
 ................
  


  
 

  

  
   
  

Template Sequence  WLDPKEATYLRWIAVGK. . . . . . . . . . . . . . . . TXEEIADVEGVKYNSVRVKLREAXKRF
Template Known Secondary structure 


TTT
................
TT

Template Predicted Secondary structure 





................




Template SS confidence 



























































   173......180......... 190.........200.........210......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions