Return to main results Retrieve Phyre Job Id

Job DescriptionP32162
Confidence6.36%DateThu Jan 5 11:49:42 GMT 2012
Rank22Aligned Residues38
% Identity8%Templatec3uajA_
PDB info PDB header:viral protein/immune systemChain: A: PDB Molecule:envelope protein; PDBTitle: crystal structure of the envelope glycoprotein ectodomain from dengue2 virus serotype 4 in complex with the fab fragment of the chimpanzee3 monoclonal antibody 5h2
Resolution3.23 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   18.20.........30.........40.........50.........60.........70.........80.........90....
Predicted Secondary structure 

















Query SS confidence 












































































Query Sequence  GTVIDNDNCTSKFSRFFATREEAESFMTKLKELAAATSSADEGASVAYKIKDLEGQVELDAAFTFSCQAEMIIFELS
Query Conservation 





 
          
   

  

 
 



 


   
  
 
 
    

  
 
 
 











 
Alig confidence 


















.......................................


















Template Conservation 
  
  


 
 
 
 


.......................................   





 

  
  

Template Sequence  GNLVQIENLEYTVVVTVHN. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . HGVTAMITPRSPSVEVKLP
Template Known Secondary structure 

TTS


.......................................

BTTB
T
Template Predicted Secondary structure 




.......................................






Template SS confidence 












































































   127..130.........140..... ....150.........160....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions