Return to main results Retrieve Phyre Job Id

Job DescriptionP29018
Confidence95.17%DateThu Jan 5 11:45:34 GMT 2012
Rank241Aligned Residues43
% Identity21%Templatec2gesA_
PDB info PDB header:transferaseChain: A: PDB Molecule:pantothenate kinase; PDBTitle: pantothenate kinase from mycobacterium tuberculosis (mtpank) in2 complex with a coenzyme a derivative, form-i (rt)
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   378.380.........390.........400.........410.........420.........430......
Predicted Secondary structure 



































Query SS confidence 


























































Query Sequence  RAVLVGRSGSGKSSLLNALSGFLSYQGSLRINGIELRDLSPESWRKHLSWVGQNPQLPA
Query Conservation     
 
 







   
 
     
 
                  
  
 
   

 
Alig confidence 





























................












Template Conservation 





 






 
  
   
       ................ 
  

 
 
   
Template Sequence  IIGVAGSVAVGKSTTARVLQALLARWDHHP. . . . . . . . . . . . . . . . RVDLVTTDGFLYP
Template Known Secondary structure 
TTSSSSTT

................
GGGGB

Template Predicted Secondary structure 











................







Template SS confidence 


























































   92.......100.........110.........120. ........130....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions