Return to main results Retrieve Phyre Job Id

Job DescriptionP03817
Confidence39.69%DateThu Jan 5 10:58:00 GMT 2012
Rank142Aligned Residues31
% Identity23%Templatec2pi1C_
PDB info PDB header:oxidoreductaseChain: C: PDB Molecule:d-lactate dehydrogenase; PDBTitle: crystal structure of d-lactate dehydrogenase from aquifex2 aeolicus complexed with nad and lactic acid
Resolution2.12 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   80.........90.........100.........110........
Predicted Secondary structure 










Query SS confidence 






































Query Sequence  LSAVRFGAIGIGSREYDTFCGAIDKLEAELKNSGAKQTG
Query Conservation    
   



 

  
  
      
   
   
   
 
Alig confidence 













........
















Template Conservation 
 
  




 
 
........
  

  
 



 
  
Template Sequence  LNRLTLGVIGTGRI. . . . . . . . GSRVAXYGLAFGXKVLC
Template Known Secondary structure  GGGS

S........TT
Template Predicted Secondary structure 





........



Template SS confidence 






































   139140.........150.. .......160.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions