Return to main results Retrieve Phyre Job Id

Job DescriptionP03024
Confidence95.46%DateThu Jan 5 10:57:56 GMT 2012
Rank110Aligned Residues25
% Identity32%Templatec3iwfA_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:transcription regulator rpir family; PDBTitle: the crystal structure of the n-terminal domain of a rpir2 transcriptional regulator from staphylococcus epidermidis to 1.4a
Resolution1.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40.....
Predicted Secondary structure 












Query SS confidence 










































Query Sequence  TIKDVARLAGVSVATVSRVINNSPKASEASRLAVHSAMESLSY
Query Conservation 

 


  



  






    

  

 

   
  


Alig confidence 



















..................




Template Conservation 

 


    

 


 

 ..................




Template Sequence  TSQEIANQLETSSTSIIRLS. . . . . . . . . . . . . . . . . . KKVTP
Template Known Secondary structure 
TS
..................ST
Template Predicted Secondary structure 



..................

Template SS confidence 










































   37..40.........50...... ...60.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions