Return to main results Retrieve Phyre Job Id

Job DescriptionP03024
Confidence94.26%DateThu Jan 5 10:57:56 GMT 2012
Rank134Aligned Residues30
% Identity23%Templatec2ev5B_
PDB info PDB header:transcriptionChain: B: PDB Molecule:transcriptional regulator mntr; PDBTitle: bacillus subtilis manganese transport regulator (mntr)2 bound to calcium
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40......
Predicted Secondary structure 














Query SS confidence 












































Query Sequence  ATIKDVARLAGVSVATVSRVINNSPKASEASRLAVHSAMESLSYH
Query Conservation   

 


  



  






    

  

 

   
  


 
Alig confidence 






















...............






Template Conservation 
    

  
 
   


  
  ...............
   


Template Sequence  ARVSDIAEALAVHPSSVTKMVQK. . . . . . . . . . . . . . . LDKDEYL
Template Known Secondary structure 

T

...............TTS
Template Predicted Secondary structure 




...............


Template SS confidence 












































   23......30.........40..... ....50..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions