Return to main results Retrieve Phyre Job Id

Job DescriptionP75972
Confidence2.40%DateThu Jan 5 12:16:40 GMT 2012
Rank95Aligned Residues33
% Identity33%Templatec3hftA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:wbms, polysaccharide deacetylase involved in o-antigen PDBTitle: crystal structure of a putative polysaccharide deacetylase involved in2 o-antigen biosynthesis (wbms, bb0128) from bordetella bronchiseptica3 at 1.90 a resolution
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   53......60.........70.........80.........90....
Predicted Secondary structure 




















Query SS confidence 









































Query Sequence  STMNCQQILDQTFSIANSAGVDANIFVCKFEQSACLLPSASL
Query Conservation 









































Alig confidence 

















.........














Template Conservation       
 


  
 
 
 .........  






  

 
Template Sequence  HAEGVQEILDRTLELAPG. . . . . . . . . CVSVRSHSLVQATSI
Template Known Secondary structure 
S

TTSTT.........



GGG


Template Predicted Secondary structure 






.........




Template SS confidence 









































   102.......110......... 120.........130....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions