Return to main results Retrieve Phyre Job Id

Job DescriptionP23909
Confidence93.38%DateThu Jan 5 11:40:34 GMT 2012
Rank187Aligned Residues27
% Identity37%Templatec3h0kA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:upf0200 protein sso1041; PDBTitle: crystal structure of an adenylated kinase related protein from2 sulfolobus solfataricus to 3.25a
Resolution3.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   608.610.........620.........630.........640
Predicted Secondary structure 









Query SS confidence 
































Query Sequence  RMLIITGPNMGGKSTYMRQTALIALMAYIGSYV
Query Conservation     











 

 


  





  
Alig confidence 


















......







Template Conservation 


 
 
  







  ......
   
   
Template Sequence  KVILITGMPGSGKSEFAKL. . . . . . LKERGAKV
Template Known Secondary structure 


TTS
......TS
Template Predicted Secondary structure 






......


Template SS confidence 
































   910.........20....... ..30.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions