Return to main results Retrieve Phyre Job Id

Job DescriptionP23909
Confidence74.12%DateThu Jan 5 11:40:34 GMT 2012
Rank435Aligned Residues25
% Identity32%Templatec2il1A_
PDB info PDB header:protein transportChain: A: PDB Molecule:rab12; PDBTitle: crystal structure of a predicted human gtpase in complex with gdp
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   598.600.........610.........620.......
Predicted Secondary structure 









Query SS confidence 





























Query Sequence  ANPLNLSPQRRMLIITGPNMGGKSTYMRQT
Query Conservation 



 
       











 

 
Alig confidence 






.....

















Template Conservation 
 
   
.....




   






 
 
Template Sequence  PADFKLQ. . . . . VIIIGSRGVGKTSLMERF
Template Known Secondary structure 

S.....
STTSS
Template Predicted Secondary structure 



.....





Template SS confidence 





























   134.....140 .........150........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions