Return to main results Retrieve Phyre Job Id

Job DescriptionP36547
Confidence89.98%DateThu Jan 5 11:53:11 GMT 2012
Rank180Aligned Residues44
% Identity32%Templatec3h5tA_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:transcriptional regulator, laci family; PDBTitle: crystal structure of a transcriptional regulator, lacl2 family protein from corynebacterium glutamicum
Resolution2.53 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   257..260.........270.........280.........290.........300.........310.........320
Predicted Secondary structure 

















Query SS confidence 































































Query Sequence  VTVLDLCNQLHVSRRTLQNAFHAILGIGPNAWLKRIRLNAVRRELISPWSQSMTVKDAAMQWGF
Query Conservation 


  

  



 
 
   

   
 

  


  

  


 
        

 


   

Alig confidence 

































....................









Template Conservation 


 


   


  






    

  

 
....................
   
  


Template Sequence  GTLASIAAKLGISRTTVSNAYNRPEQLSAELRQR. . . . . . . . . . . . . . . . . . . . ILDTAEDMGY
Template Known Secondary structure  TTS

GGGS
....................TT
Template Predicted Secondary structure 











....................

Template SS confidence 































































   10.........20.........30.........40... ......50...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions