Return to main results Retrieve Phyre Job Id

Job DescriptionP76129
Confidence21.41%DateThu Jan 5 12:19:21 GMT 2012
Rank484Aligned Residues26
% Identity31%Templatec2r8kB_
PDB info PDB header:replication, transferase/dnaChain: B: PDB Molecule:dna polymerase eta; PDBTitle: structure of the eukaryotic dna polymerase eta in complex with 1,2-2 d(gpg)-cisplatin containing dna
Resolution3.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   467..470.........480.........490.........
Predicted Secondary structure 




Query SS confidence 
































Query Sequence  ITQIADELRNVVSKPIMIDDKPFPLTLSIGISY
Query Conservation 
  

  
   
            

 




 
Alig confidence 













.......











Template Conservation 
  

  

  
  .......




 




 
Template Sequence  GSQVCKGIRDSIKD. . . . . . . ILGYTTSCGLSS
Template Known Secondary structure  .......T


S
Template Predicted Secondary structure  .......







Template SS confidence 
































   241........250.... .....260......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions