Return to main results Retrieve Phyre Job Id

Job DescriptionP76129
Confidence31.04%DateThu Jan 5 12:19:21 GMT 2012
Rank417Aligned Residues38
% Identity26%Templatec1r46B_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:alpha-galactosidase a; PDBTitle: structure of human alpha-galactosidase
Resolution3.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   677..680.........690.........700..... ....710.........720
Predicted Secondary structure 







...................



Query SS confidence 




























. . . . . . . . . . . . . . . . . . .














Query Sequence  DTEIFKRIQILRDMGVGLSVDDFGTGFSG. . . . . . . . . . . . . . . . . . . LSRLVSLPVTEIKID
Query Conservation            
   
     



 
 

...................   
       



Alig confidence 



















......


...................














Template Conservation 
 

  
   
   
   

......
  
        
                


 

 
Template Sequence  PHGIRQLANYVHSKGLKLGI. . . . . . YADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFD
Template Known Secondary structure  TTTTTTT
......SSSB
TTSSB

TTTT

Template Predicted Secondary structure 






......














Template SS confidence 






























































   114.....120.........130... ......140.........150.........160.........170
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions