Return to main results Retrieve Phyre Job Id

Job DescriptionP63340
Confidence2.01%DateThu Jan 5 12:08:05 GMT 2012
Rank57Aligned Residues25
% Identity44%Templatec2l34A_
PDB info PDB header:protein bindingChain: A: PDB Molecule:tyro protein tyrosine kinase-binding protein; PDBTitle: structure of the dap12 transmembrane homodimer
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   21........30.........40.........50...
Predicted Secondary structure 

Query SS confidence 
































Query Sequence  VGAGTLFLPIQLGSAGAVVLFITALVAWPLTYW
Query Conservation 

 


 

      
     
           
Alig confidence 





........


















Template Conservation 
 



........







 

  





Template Sequence  VSPGVL. . . . . . . . AGIVVGDLVLTVLIALAVY
Template Known Secondary structure 

T........
Template Predicted Secondary structure 

........
Template SS confidence 
































   4..... 10.........20........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions