Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACL5
Confidence38.53%DateThu Jan 5 11:18:27 GMT 2012
Rank451Aligned Residues37
% Identity24%Templatec3kxeD_
PDB info PDB header:protein bindingChain: D: PDB Molecule:antitoxin protein pard-1; PDBTitle: a conserved mode of protein recognition and binding in a2 pard-pare toxin-antitoxin complex
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20.........30.........40.........50.......
Predicted Secondary structure 


















Query SS confidence 




















































Query Sequence  RRPICEVVAESIERLIIDGVLKVGQPLPSERRLCEKLGFSRSALREGLTVLRG
Query Conservation 
  
 
 
   
   
  
 
  
  



 



  



  




  
  
Alig confidence 























....


............









Template Conservation 



       
   
 

 
 
 ....


............

 




  
Template Sequence  SVVLGDHFQAFIDSQVADGRYGSA. . . . SEV. . . . . . . . . . . . IRAGLRLLEE
Template Known Secondary structure 




TTS
SS................
Template Predicted Secondary structure 






................
Template SS confidence 




















































   7..10.........20.........30 ... ......40...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions