Return to main results Retrieve Phyre Job Id

Job DescriptionP09833
Confidence96.80%DateThu Jan 5 11:02:30 GMT 2012
Rank206Aligned Residues44
% Identity27%Templatec2gesA_
PDB info PDB header:transferaseChain: A: PDB Molecule:pantothenate kinase; PDBTitle: pantothenate kinase from mycobacterium tuberculosis (mtpank) in2 complex with a coenzyme a derivative, form-i (rt)
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   26...30.........40.........50.........60.........70.........80.........90
Predicted Secondary structure 






























Query SS confidence 
































































Query Sequence  ITAIFGVSGAGKTSLINAISGLTRPQKGRIVLNGRVLNDAEKGICLTPEKRRVGYVFQDARLFPH
Query Conservation     
 
 








  
 
      
 
   
                
 
  
 
   
   
Alig confidence 





























.....................













Template Conservation 





 






 
  
   
       ..................... 
  

 
 
    
Template Sequence  IIGVAGSVAVGKSTTARVLQALLARWDHHP. . . . . . . . . . . . . . . . . . . . . RVDLVTTDGFLYPN
Template Known Secondary structure 
TTSSSSTT

.....................
GGGGB

Template Predicted Secondary structure 











.....................







Template SS confidence 
































































   92.......100.........110.........120. ........130.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions