Return to main results Retrieve Phyre Job Id

Job DescriptionP0AE22
Confidence95.72%DateThu Jan 5 11:22:16 GMT 2012
Rank116Aligned Residues49
% Identity22%Templatec2i55C_
PDB info PDB header:isomeraseChain: C: PDB Molecule:phosphomannomutase; PDBTitle: complex of glucose-1,6-bisphosphate with phosphomannomutase from2 leishmania mexicana
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   66...70.........80.........90.........100.........110.........120.........130.........140.....
Predicted Secondary structure 






























Query SS confidence 















































































Query Sequence  VGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRSPTKTE
Query Conservation 














           
  

 
   
  

    
 



  
 

   
  


 






      
Alig confidence 











.................................






.


























Template Conservation 
  






  .................................   
   .   

  
   

 
 




      
Template Sequence  LLFDVDGTLTPP. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . RNPETHD. MKEALLKARAAGFKLGVVGGSDFAKQK
Template Known Secondary structure  STTTTSST.................................TS


.TT
SS
Template Predicted Secondary structure 







.................................




.






Template SS confidence 















































































   7..10........ .20..... ....30.........40.........50..
 
   146..
Predicted Secondary structure 
Query SS confidence 


Query Sequence  TVS
Query Conservation   
 
Alig confidence 


Template Conservation     
Template Sequence  EQL
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 


   53..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions