Return to main results Retrieve Phyre Job Id

Job DescriptionP0CF86
Confidence31.35%DateThu Jan 5 11:31:43 GMT 2012
Rank358Aligned Residues35
% Identity6%Templatec1sjiA_
PDB info PDB header:metal binding proteinChain: A: PDB Molecule:calsequestrin, cardiac muscle isoform; PDBTitle: comparing skeletal and cardiac calsequestrin structures and2 their calcium binding: a proposed mechanism for coupled3 calcium binding and protein polymerization
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10..... ....20.........30........
Predicted Secondary structure 



..............







Query SS confidence 











. . . . . . . . . . . . . .






















Query Sequence  ITIYHNPACGTS. . . . . . . . . . . . . . RNTLEMLHNNGNEPTIINYLDMP
Query Conservation 



  
 
  
..............



  
   

     

   
Alig confidence 











..............






















Template Conservation 

 

 


  

   
                    
  
 


    
Template Sequence  LCLYYHESVSSDKVAQKQFQLKEIVLELVAQVLEHKDIGFVMVDAKKEA
Template Known Secondary structure 

S
SSSTTSGGGSSTTTT
Template Predicted Secondary structure 












Template SS confidence 
















































   33......40.........50.........60.........70.........80.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions