Return to main results Retrieve Phyre Job Id

Job DescriptionP71239
Confidence13.77%DateThu Jan 5 12:12:31 GMT 2012
Rank65Aligned Residues33
% Identity24%Templatec3ssoE_
PDB info PDB header:transferaseChain: E: PDB Molecule:methyltransferase; PDBTitle: myce methyltransferase from the mycinamycin biosynthetic pathway in2 complex with mg and sah, crystal form 2
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40...
Predicted Secondary structure 















Query SS confidence 









































Query Sequence  LLSIITVAFRNLEGIVKTHASLAHLAQVEDISFEWIVVDGGS
Query Conservation 






 

    
   
 

  

       






 
Alig confidence 

























.........






Template Conservation 

 
  


 
  

  
  
 



.........






Template Sequence  RIRTIQGDQNDAEFLDRIARRYGPFD. . . . . . . . . IVIDDGS
Template Known Secondary structure  T

TT


.........
S
Template Predicted Secondary structure 








.........


Template SS confidence 









































   245....250.........260.........270 .......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions