Return to main results Retrieve Phyre Job Id

Job DescriptionP46125
Confidence4.03%DateThu Jan 5 12:04:03 GMT 2012
Rank51Aligned Residues38
% Identity18%Templated1urfa_
SCOP infoLong alpha-hairpin HR1 repeat HR1 repeat
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   103......110.........120.........130.........140.........150...
Predicted Secondary structure 












Query SS confidence 


















































Query Sequence  EGVEKVLHMLEARKHKEDPAQSQQRLEKLAAQDPLKFEKDKIKGAIRTDFI
Query Conservation 

 


 
    
   
                    

 










Alig confidence 











.....









........















Template Conservation 





      .....    


   ........


  
 

  

 

Template Sequence  QGAENMIQTYSN. . . . . GSTKDRKLLL. . . . . . . . TAQQMLQDSKTKIDII
Template Known Secondary structure  .....SSS

........
Template Predicted Secondary structure 
.....


........
Template SS confidence 


















































   143......150.... .....160.... .....170.........180
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions