Return to main results Retrieve Phyre Job Id

Job DescriptionP46125
Confidence58.56%DateThu Jan 5 12:04:03 GMT 2012
Rank1Aligned Residues25
% Identity28%Templatec2l9uA_
PDB info PDB header:membrane proteinChain: A: PDB Molecule:receptor tyrosine-protein kinase erbb-3; PDBTitle: spatial structure of dimeric erbb3 transmembrane domain
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   88.90.........100.........110........
Predicted Secondary structure 

Query SS confidence 






























Query Sequence  AITPLLMIGGAFLCFEGVEKVLHMLEARKHK
Query Conservation 
















 


 
    
   
Alig confidence 


















......





Template Conservation 


















......





Template Sequence  LVVIFMMLGGTFLYWRGRR. . . . . . HHHHHH
Template Known Secondary structure  ......

S

Template Predicted Secondary structure 




......





Template SS confidence 






























   652.......660.........670 ......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions