Return to main results Retrieve Phyre Job Id

Job DescriptionP0AC47
Confidence31.08%DateWed Jan 25 15:20:23 GMT 2012
Rank160Aligned Residues33
% Identity9%Templatec2kd0A_
PDB info PDB header:signaling proteinChain: A: PDB Molecule:lrr repeats and ubiquitin-like domain-containing PDBTitle: nmr solution structure of o64736 protein from arabidopsis2 thaliana. northeast structural genomics consortium mega3 target ar3445a
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6...10.........20.........30.........40.......
Predicted Secondary structure 













Query SS confidence 









































Query Sequence  NLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDN
Query Conservation       
 
 
           


      


  
  
   
Alig confidence 






.


........






















Template Conservation 

 
 

.  
........    
 
    

  

  
   
Template Sequence  TIKLTVK. FGG. . . . . . . . KSIPLSVSPDCTVKDLKSQLQPI
Template Known Secondary structure 
.TT........
TTSB
Template Predicted Secondary structure  .

........




Template SS confidence 









































   12...... .20. ........30.........40....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions