Return to main results Retrieve Phyre Job Id

Job DescriptionP0A742
Confidence2.92%DateThu Jan 5 11:04:44 GMT 2012
Rank74Aligned Residues27
% Identity37%Templatec3g9kD_
PDB info PDB header:hydrolaseChain: D: PDB Molecule:capsule biosynthesis protein capd; PDBTitle: crystal structure of bacillus anthracis transpeptidase enzyme capd
Resolution1.79 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   14.....20.........30.........40.........50.
Predicted Secondary structure 




Query SS confidence 





































Query Sequence  GNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGG
Query Conservation 












 

  

 


 


 


  
 
 
Alig confidence 








...........

















Template Conservation 








...........    
 

 
   




Template Sequence  GSAVDAAIV. . . . . . . . . . . VSYVLGVVELHASGIGGG
Template Known Secondary structure 

...........STTT

TTS
Template Predicted Secondary structure 

...........









Template SS confidence 





































   70........ .80.........90......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions