Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAJ8
Confidence20.73%DateThu Jan 5 11:13:07 GMT 2012
Rank78Aligned Residues22
% Identity27%Templatec2fugA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:nadh-quinone oxidoreductase chain 1; PDBTitle: crystal structure of the hydrophilic domain of respiratory complex i2 from thermus thermophilus
Resolution3.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   135....140.... .....150......
Predicted Secondary structure 





.................




Query SS confidence 









. . . . . . . . . . . . . . . . .











Query Sequence  TGIVHYDKDV. . . . . . . . . . . . . . . . . CTGCRYCMVACP
Query Conservation   


 

 
 .................




 
  


Alig confidence 









.................











Template Conservation 





      
  
     
   





 


 


Template Sequence  GGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVA
Template Known Secondary structure  TTTS


S

TTTT
Template Predicted Secondary structure 














Template SS confidence 






































   326...330.........340.........350.........360....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions