Return to main results Retrieve Phyre Job Id

Job DescriptionP39270
Confidence6.35%DateThu Jan 5 11:58:41 GMT 2012
Rank25Aligned Residues25
% Identity20%Templatec3nixF_
PDB info PDB header:oxidoreductaseChain: F: PDB Molecule:flavoprotein/dehydrogenase; PDBTitle: crystal structure of flavoprotein/dehydrogenase from cytophaga2 hutchinsonii. northeast structural genomics consortium target chr43.
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   169170.........180.........190.........200.......
Predicted Secondary structure 






Query SS confidence 






































Query Sequence  QGDQWDTQSDMFCALLGALTTVIFLARFHCRQLRRFGLI
Query Conservation 


 






  
 


  

      
 
       
Alig confidence 









..............














Template Conservation            ..............        
  
   
Template Sequence  AGYVWDKNNP. . . . . . . . . . . . . . FVKKHNTILKTLAKV
Template Known Secondary structure  TT
TT
TTS..............TTTT
Template Predicted Secondary structure 





..............
Template SS confidence 






































   382.......390. ........400......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions