Return to main results Retrieve Phyre Job Id

Job DescriptionP0AA49
Confidence1.07%DateThu Jan 5 11:11:55 GMT 2012
Rank31Aligned Residues34
% Identity18%Templatec3ig3A_
PDB info PDB header:signaling protein, membrane proteinChain: A: PDB Molecule:plxna3 protein; PDBTitle: crystal strucure of mouse plexin a3 intracellular domain
Resolution1.99 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   165....170.........180.........190.........200........
Predicted Secondary structure 




Query SS confidence 











































Query Sequence  SALISAAKEPVVWAPVLATILVLVGVKIPAAWDPTFNLIAKANS
Query Conservation           
 
 
 
 

         
  
   
  
     
Alig confidence 












..........




















Template Conservation 









 

..........


 

  

 









Template Sequence  RFWVNVIKNPQFV. . . . . . . . . . FDIHKNSITDACLSVVAQTFM
Template Known Secondary structure  T
GGGT..........BS



Template Predicted Secondary structure 


..........






Template SS confidence 











































   1724.....1730...... ...1740.........1750.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions