Return to main results Retrieve Phyre Job Id

Job DescriptionQ47153
Confidence14.35%DateThu Jan 5 12:36:28 GMT 2012
Rank49Aligned Residues27
% Identity22%Templated1wpga4
SCOP infoCalcium ATPase, transmembrane domain M Calcium ATPase, transmembrane domain M Calcium ATPase, transmembrane domain M
Resolution2.30

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   25....30.........40.........50.........60....
Predicted Secondary structure 







Query SS confidence 







































Query Sequence  ISEVSARFTLDAMPGKQMAIDADLNAGLINQAQAQTRRKD
Query Conservation 























 



   


 

  
Alig confidence 







............







.










Template Conservation   
 
   
............      

.
  

  
   
Template Sequence  TEECLAYF. . . . . . . . . . . . GVSETTGL. TPDQVKRHLEK
Template Known Secondary structure  ............T

TTT

.
Template Predicted Secondary structure 
............




.
Template SS confidence 







































   910...... ...20.... .....30.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions