Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABS8
Confidence2.87%DateThu Jan 5 11:16:15 GMT 2012
Rank52Aligned Residues26
% Identity23%Templated1ufaa1
SCOP infoimmunoglobulin/albumin-binding domain-like Families 57/38 glycoside transferase middle domain AmyC C-terminal domain-like
Resolution2.20

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   12.......20.........30.........40...
Predicted Secondary structure 





Query SS confidence 































Query Sequence  EMDKVNVDLAAAGVAFKERYNMPVIAEAVERE
Query Conservation 
 





















 

 

  
Alig confidence 













.



.....







Template Conservation   

  
  
     .
 

..... 
 




Template Sequence  RAEGAXREAARRGV. LPEG. . . . . VLRQAXRE
Template Known Secondary structure 

.S
.....
Template Predicted Secondary structure 


......
Template SS confidence 































   427..430.........440 .... .....450..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions