Return to main results Retrieve Phyre Job Id

Job DescriptionP64534
Confidence14.45%DateThu Jan 5 12:09:15 GMT 2012
Rank12Aligned Residues25
% Identity16%Templatec2zbkB_
PDB info PDB header:isomeraseChain: B: PDB Molecule:type 2 dna topoisomerase 6 subunit b; PDBTitle: crystal structure of an intact type ii dna topoisomerase:2 insights into dna transfer mechanisms
Resolution3.56 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   68.70.........80.........90.........100
Predicted Secondary structure 
















Query SS confidence 
































Query Sequence  QWQLRNLPAPDAGTHWTYMGGAYVLISDTDGKI
Query Conservation 

  
 
  

 
  


   




   

 
Alig confidence 










........













Template Conservation   
  
      ........      
 
 
  
Template Sequence  DWKRYGIESDQ. . . . . . . . YQMVVMVHLCSTKI
Template Known Secondary structure 
TTSSS


SS........B
SS
Template Predicted Secondary structure 










........







Template SS confidence 
































   396...400...... ...410.........420
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions