Return to main results Retrieve Phyre Job Id

Job DescriptionP64534
Confidence9.26%DateThu Jan 5 12:09:15 GMT 2012
Rank21Aligned Residues22
% Identity9%Templatec1mx0D_
PDB info PDB header:isomeraseChain: D: PDB Molecule:type ii dna topoisomerase vi subunit b; PDBTitle: structure of topoisomerase subunit
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   68.70.........80.........90.......
Predicted Secondary structure 















Query SS confidence 





























Query Sequence  QWQLRNLPAPDAGTHWTYMGGAYVLISDTD
Query Conservation 

  
 
  

 
  


   




   
Alig confidence 










........










Template Conservation   
  
 
    ........ 
    
 
 
Template Sequence  DWKRYGIESDQ. . . . . . . . YQXVVXVHLCS
Template Known Secondary structure 
SGGGT

SS
........B

Template Predicted Secondary structure 










........


Template SS confidence 





























   396...400...... ...410.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions