Return to main results Retrieve Phyre Job Id

Job DescriptionP43674
Confidence22.96%DateThu Jan 5 12:02:29 GMT 2012
Rank110Aligned Residues24
% Identity29%Templated1np3a1
SCOP info6-phosphogluconate dehydrogenase C-terminal domain-like 6-phosphogluconate dehydrogenase C-terminal domain-like Acetohydroxy acid isomeroreductase (ketol-acid reductoisomerase, KARI)
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   191........200 .........210....
Predicted Secondary structure  ................



Query SS confidence 









. . . . . . . . . . . . . . . .













Query Sequence  DKESEADDFS. . . . . . . . . . . . . . . . FDLLKKRGISTQGL
Query Conservation    
 


  
................      

  
   
Alig confidence 









................













Template Conservation    









 

 


  

 
 

 




  

 
Template Sequence  KDETETDLFGEQAVLCGGCVELVKAGFETLVEAGYAPEMA
Template Known Secondary structure  TTTTT

Template Predicted Secondary structure 





Template SS confidence 







































   184.....190.........200.........210.........220...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions