Return to main results Retrieve Phyre Job Id

Job DescriptionQ46845
Confidence23.51%DateThu Jan 5 12:35:12 GMT 2012
Rank252Aligned Residues32
% Identity22%Templatec2ywxA_
PDB info PDB header:lyaseChain: A: PDB Molecule:phosphoribosylaminoimidazole carboxylase catalytic subunit; PDBTitle: crystal structure of phosphoribosylaminoimidazole carboxylase2 catalytic subunit from methanocaldococcus jannaschii
Resolution2.31 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   53......60.........70.........80.........90....
Predicted Secondary structure 














Query SS confidence 









































Query Sequence  PNGQKVTIMLEELLALGVTGAEYDAWLIRIGDGDQFSSGFVE
Query Conservation   
  

   



      




   


  

  




 
Alig confidence 












......








....









Template Conservation       
   
   ......

  

 
 ....



    
 
Template Sequence  KIAEKAVNILKEF. . . . . . GVEFEVRVA. . . . SAHRTPELVE
Template Known Secondary structure  T......T


....
TTT
Template Predicted Secondary structure 
......


....



Template SS confidence 









































   13......20..... ....30.... .....40....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions