Return to main results Retrieve Phyre Job Id

Job DescriptionP00957
Confidence38.17%DateThu Jan 5 10:57:20 GMT 2012
Rank87Aligned Residues28
% Identity29%Templated1tvca2
SCOP infoFerredoxin reductase-like, C-terminal NADP-linked domain Ferredoxin reductase-like, C-terminal NADP-linked domain Aromatic dioxygenase reductase-like
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   138.140.........150.........160.........170.........180..
Predicted Secondary structure 





























Query SS confidence 












































Query Sequence  EAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC
Query Conservation 
   

    

    
            




  
  





Alig confidence 


















...........


......





Template Conservation    
   
   

    
  ...........
 
......      
Template Sequence  DAACELVRSRGIPGEQVFF. . . . . . . . . . . EKF. . . . . . LPSGAA
Template Known Secondary structure 



S...........


......SSS


Template Predicted Secondary structure 



...........
......





Template SS confidence 












































   224.....230.........240.. ... ....250.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions