Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAG0
Confidence97.26%DateThu Jan 5 11:12:50 GMT 2012
Rank134Aligned Residues39
% Identity21%Templated1qhla_
SCOP infoP-loop containing nucleoside triphosphate hydrolases P-loop containing nucleoside triphosphate hydrolases ABC transporter ATPase domain-like
Resolution2.20

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40.........50....
Predicted Secondary structure 

















Query SS confidence 


















































Query Sequence  LNVDKLSVHFGDESAPFRAVDRISYSVKQGEVVGIVGESGSGKSVSSLAIM
Query Conservation 
 
 

   
        

  


 
  


  


 







   
 
Alig confidence 





...........












.



















Template Conservation 
 
 
 ...........       
 
   .

 
 
 








 

 
Template Sequence  LTLINW. . . . . . . . . . . NGFFARTFDLDEL. VTTLSGGNGAGKSTTMAAFV
Template Known Secondary structure  ...........TT
.S

S
Template Predicted Secondary structure 
...........







.





Template SS confidence 


















































   10..... ....20........ .30.........40........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions