Return to main results Retrieve Phyre Job Id

Job DescriptionP30015
Confidence84.32%DateWed Jan 25 15:20:48 GMT 2012
Rank327Aligned Residues31
% Identity29%Templated1nija1
SCOP infoP-loop containing nucleoside triphosphate hydrolases P-loop containing nucleoside triphosphate hydrolases Nitrogenase iron protein-like
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   47..50.........60.........70.........80.........90..
Predicted Secondary structure 





















Query SS confidence 













































Query Sequence  ALVIAPTGSGKTLAAFLYALDRLFREGGEDTREAHKRKTSRILYIS
Query Conservation   

 










 
  
  
                   


 
Alig confidence 











.....









..........








Template Conservation   










.....


  

   .......... 
 




 
Template Sequence  TLLTGFLGAGKT. . . . . TLLRHILNEQ. . . . . . . . . . HGYKIAVIE
Template Known Secondary structure  SSSSS
.....S
..........




Template Predicted Secondary structure 





.....
..........


Template SS confidence 













































   7..10........ .20........ .30.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions