Return to main results Retrieve Phyre Job Id

Job DescriptionP30015
Confidence88.28%DateWed Jan 25 15:20:48 GMT 2012
Rank278Aligned Residues47
% Identity21%Templatec3pvsA_
PDB info PDB header:recombinationChain: A: PDB Molecule:replication-associated recombination protein a; PDBTitle: structure and biochemical activities of escherichia coli mgsa
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   46...50.........60.........70.........80.........90.........100........
Predicted Secondary structure 
























Query SS confidence 






























































Query Sequence  HALVIAPTGSGKTLAAFLYALDRLFREGGEDTREAHKRKTSRILYISPIKALGTDVQRNLQIP
Query Conservation    

 










 
  
  
                   


 
 


  
    
   
Alig confidence 



















................


























Template Conservation 



 










  

................      

 


    
  

 

  
Template Sequence  SMILWGPPGTGKTTLAEVIA. . . . . . . . . . . . . . . . RYANADVERISAVTSGVKEIREAIERA
Template Known Secondary structure 
STTSS................TT
TTT

Template Predicted Secondary structure 





................








Template SS confidence 






























































   52.......60.........70. ........80.........90........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions