Return to main results Retrieve Phyre Job Id

Job DescriptionP30015
Confidence75.43%DateWed Jan 25 15:20:48 GMT 2012
Rank375Aligned Residues25
% Identity16%Templatec3neyC_
PDB info PDB header:membrane proteinChain: C: PDB Molecule:55 kda erythrocyte membrane protein; PDBTitle: crystal structure of the kinase domain of mpp1/p55
Resolution2.26 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   43......50.........60.........70..
Predicted Secondary structure 










Query SS confidence 





























Query Sequence  RSEHALVIAPTGSGKTLAAFLYALDRLFRE
Query Conservation   
   

 










 
  
  
   
Alig confidence 















.....








Template Conservation    
 


 



 

 .....

   
   
Template Sequence  GRKTLVLIGASGVGRS. . . . . HIKNALLSQ
Template Known Secondary structure  S



TTSS.....
Template Predicted Secondary structure 








.....
Template SS confidence 





























   281........290...... ...300.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions