Return to main results Retrieve Phyre Job Id

Job DescriptionP30015
Confidence92.58%DateWed Jan 25 15:20:48 GMT 2012
Rank223Aligned Residues28
% Identity57%Templatec3hteC_
PDB info PDB header:motor proteinChain: C: PDB Molecule:atp-dependent clp protease atp-binding subunit clpx; PDBTitle: crystal structure of nucleotide-free hexameric clpx
Resolution4.03 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   34.....40. ........50.........60.
Predicted Secondary structure  ............









Query SS confidence 







. . . . . . . . . . . .



















Query Sequence  QPQTWHVA. . . . . . . . . . . . ARSEHALVIAPTGSGKTLAA
Query Conservation 
  
   
............  
   

 










Alig confidence 







............



















Template Conservation 
      
  

             


 







 

Template Sequence  QEQAKKVLAVAVYNHYKRLRNGKSNILLIGPTGSGKTLLA
Template Known Secondary structure 






TTSS
Template Predicted Secondary structure 













Template SS confidence 







































   81........90.........100.........110.........120
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions