Return to main results Retrieve Phyre Job Id

Job DescriptionP30015
Confidence85.33%DateWed Jan 25 15:20:48 GMT 2012
Rank317Aligned Residues38
% Identity21%Templatec2qq0B_
PDB info PDB header:transferaseChain: B: PDB Molecule:thymidine kinase; PDBTitle: thymidine kinase from thermotoga maritima in complex with2 thymidine + appnhp
Resolution1.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   43......50.........60.........70.........80.........90...
Predicted Secondary structure 


























Query SS confidence 


















































Query Sequence  RSEHALVIAPTGSGKTLAAFLYALDRLFREGGEDTREAHKRKTSRILYISP
Query Conservation   
   

 










 
  
  
                   


 
Alig confidence 






























.............






Template Conservation   
 
 

 


 




 

           ............. 
 
 
 
Template Sequence  SGKLTVITGPMYSGKTTELLSFVEIYKLGKK. . . . . . . . . . . . . KVAVFKP
Template Known Secondary structure 



STTSSTT
.............
Template Predicted Secondary structure 









.............
Template SS confidence 


















































   2.......10.........20.........30.. .......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions