Return to main results Retrieve Phyre Job Id

Job DescriptionP23886
Confidence95.65%DateThu Jan 5 11:40:21 GMT 2012
Rank211Aligned Residues49
% Identity22%Templatec3tqcB_
PDB info PDB header:transferaseChain: B: PDB Molecule:pantothenate kinase; PDBTitle: structure of the pantothenate kinase (coaa) from coxiella burnetii
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   368.370.........380.........390.........400.........410.........420.........430...
Predicted Secondary structure 

































Query SS confidence 

































































Query Sequence  HIAILGRTGCGKSTLLQQLTRAWDPQQGEILLNDSPIASLNEAALRQTISVVPQRVHLFSATLRDN
Query Conservation     


 








  
 
      
 
   
  
           
  
 
   

  

 

Alig confidence 




























.................



















Template Conservation 





 






 
  
   
      .................  
  

 
 
         
Template Sequence  IIGIAGSVAVGKSTTSRVLKALLSRWPDH. . . . . . . . . . . . . . . . . PNVEVITTDGFLYSNAKLEK
Template Known Secondary structure 
TTSSTTSTT
.................

GGGGB

Template Predicted Secondary structure 










.................










Template SS confidence 

































































   91........100.........110......... 120.........130.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions