Return to main results Retrieve Phyre Job Id

Job DescriptionP0AD65
Confidence22.86%DateThu Jan 5 11:20:07 GMT 2012
Rank114Aligned Residues35
% Identity34%Templatec2x5qA_
PDB info PDB header:unknown functionChain: A: PDB Molecule:sso1986; PDBTitle: crystal structure of hypothetical protein sso1986 from2 sulfolobus solfataricus p2
Resolution2.05 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   275....280.........290.........300.........310.........320.........330...
Predicted Secondary structure 



































Query SS confidence 


























































Query Sequence  VTDPRTGGVLALVSTPSYDPNLFVDGISSKDYSALLNDPNTPLVNRATQGVYPPASTVK
Query Conservation 


  

 





 
 



             
         


    
 





Alig confidence 









.....











...................












Template Conservation 






 

.....











...................

 
 
      
Template Sequence  AIDESTGELV. . . . . PTFDPCDYVKGI. . . . . . . . . . . . . . . . . . . LISGKILKGNHFK
Template Known Secondary structure  TTTT.....
S
TT
...................S
Template Predicted Secondary structure 




.....
...................




Template SS confidence 


























































   62.......70. ........80... ......90......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions