Return to main results Retrieve Phyre Job Id

Job DescriptionP27300
Confidence35.58%DateThu Jan 5 11:43:46 GMT 2012
Rank471Aligned Residues30
% Identity27%Templatec1naaB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:cellobiose dehydrogenase; PDBTitle: cellobiose dehydrogenase flavoprotein fragment in complex with2 cellobionolactam
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   48.50.........60.........70.........80.....
Predicted Secondary structure 












Query SS confidence 





































Query Sequence  VVVVGNLTAGGNGKTPVVVWLVEQLQQRGIRVGVVSRG
Query Conservation 















 
  

  
   
    




Alig confidence 











........

















Template Conservation 






  
  ........ 
  

  
  




 
Template Sequence  YIIVGAGPGGII. . . . . . . . AADRLSEAGKKVLLLERG
Template Known Secondary structure 

S........TT

SS
Template Predicted Secondary structure 


........




Template SS confidence 





































   219220.........230 .........240........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions