Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACQ0
Confidence92.82%DateThu Jan 5 11:18:41 GMT 2012
Rank178Aligned Residues31
% Identity26%Templatec3ctaA_
PDB info PDB header:transferaseChain: A: PDB Molecule:riboflavin kinase; PDBTitle: crystal structure of riboflavin kinase from thermoplasma2 acidophilum
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40......
Predicted Secondary structure 















Query SS confidence 













































Query Sequence  MATMKDVARLAGVSTSTVSHVINKDRFVSEAITAKVEAAIKELNYA
Query Conservation 
 

 


  



  





     

  

 

   
 



 
Alig confidence 























...............






Template Conservation   

  


  
  
  
 

 
  ...............

  
 
Template Sequence  YLTSSKLADMLGISQQSASRIIID. . . . . . . . . . . . . . . LEKNGYI
Template Known Secondary structure 

TS
...............TTS
Template Predicted Secondary structure 





...............


Template SS confidence 













































   25....30.........40........ .50.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions