Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACQ0
Confidence88.23%DateThu Jan 5 11:18:41 GMT 2012
Rank392Aligned Residues30
% Identity17%Templatec2nnnB_
PDB info PDB header:transcriptionChain: B: PDB Molecule:probable transcriptional regulator; PDBTitle: crystal structure of probable transcriptional regulator from2 pseudomonas aeruginosa
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40......
Predicted Secondary structure 














Query SS confidence 












































Query Sequence  ATMKDVARLAGVSTSTVSHVINKDRFVSEAITAKVEAAIKELNYA
Query Conservation   

 


  



  





     

  

 

   
 



 
Alig confidence 






















...............






Template Conservation   
  


         

  
  ...............
   
 
Template Sequence  CPQNQLGRLTAXDAATIKGVVER. . . . . . . . . . . . . . . LDKRGLI
Template Known Secondary structure  B
TT

...............TT
Template Predicted Secondary structure 




...............
Template SS confidence 












































   53......60.........70..... ....80..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions