Return to main results Retrieve Phyre Job Id

Job DescriptionP42591
Confidence4.03%DateThu Jan 5 12:01:37 GMT 2012
Rank47Aligned Residues20
% Identity45%Templatec3obhA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein; PDBTitle: x-ray crystal structure of protein sp_0782 (7-79) from streptococcus2 pneumoniae. northeast structural genomics consortium target spr104
Resolution1.89 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   93......100. ........110..
Predicted Secondary structure 

..........









Query SS confidence 








. . . . . . . . . .










Query Sequence  GEGWTVQAD. . . . . . . . . . HDGNAWVPDHS
Query Conservation          
..........     
     
Alig confidence 








..........










Template Conservation    

 



 



   





 
  
  
Template Sequence  EKGWTKEINRVSFNGAPAKFDIRAWSPDHT
Template Known Secondary structure  TTS
TT



TTSS
Template Predicted Secondary structure 














Template SS confidence 





























   27..30.........40.........50......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions