Return to main results Retrieve Phyre Job Id

Job DescriptionB8LFD5
Confidence83.93%DateThu Jan 5 10:55:39 GMT 2012
Rank457Aligned Residues44
% Identity16%Templatec1p4xA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:staphylococcal accessory regulator a homologue; PDBTitle: crystal structure of sars protein from staphylococcus aureus
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20....... ..30.. .......40........
Predicted Secondary structure 






...............




....

Query SS confidence 






















. . . . . . . . . . . . . . .




. . . .















Query Sequence  KPVTLYDVAEYAGVSYQTVSRVV. . . . . . . . . . . . . . . NQASH. . . . VSAKTREKVEAAMAEL
Query Conservation 

 

 


  



  





...............
    ....

  

 

   
  
Alig confidence 






















...............




....















Template Conservation    

  


  
  
 
 

  
  
  

 
 
     
 
   
 

  
   
       
Template Sequence  NTLPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLF
Template Known Secondary structure  SSSS
GGGTTTS

SSSTTS

Template Predicted Secondary structure 















Template SS confidence 






























































   4950.........60.........70.........80.........90.........100.........110.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions