Return to main results Retrieve Phyre Job Id

Job DescriptionP39389
Confidence82.81%DateThu Jan 5 12:00:20 GMT 2012
Rank455Aligned Residues32
% Identity16%Templatec2fjrB_
PDB info PDB header:transcription regulatorChain: B: PDB Molecule:repressor protein ci; PDBTitle: crystal structure of bacteriophage 186
Resolution1.95 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20.........30.........40.....
Predicted Secondary structure 














Query SS confidence 








































Query Sequence  QHLATLLAERIEQGLYRHGEKLPSVRSLSQEHGVSISTVQQ
Query Conservation   

   
   
  
 
  
 



 
 

  
 

  

  
Alig confidence 










.......


..

















Template Conservation   
 
 

    .......
  ..

 


  



  


 
Template Sequence  VDVLDRICEAY. . . . . . . GFS. . QKIQLANHFDIASSSLSN
Template Known Secondary structure  .......T
S..
TTTTT

Template Predicted Secondary structure 
.......


..



Template SS confidence 








































   11........20. ... .....30.........40..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions