Return to main results Retrieve Phyre Job Id

Job DescriptionP58034
Confidence6.46%DateThu Jan 5 12:06:32 GMT 2012
Rank5Aligned Residues18
% Identity28%Templated1qf9a_
SCOP infoP-loop containing nucleoside triphosphate hydrolases P-loop containing nucleoside triphosphate hydrolases Nucleotide and nucleoside kinases
Resolution1.70

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30......
Predicted Secondary structure 












Query SS confidence 



































Query Sequence  MNNSNNLDYFTLYIIFSIAFMLITLLVILIAKPSTG
Query Conservation 

    

   

 
 
  
 


 



     
 
Alig confidence 





..................











Template Conservation 
   

..................  
 
 
  


Template Sequence  MEKSKP. . . . . . . . . . . . . . . . . . NVVFVLGGPGSG
Template Known Secondary structure 





..................STTSS
Template Predicted Secondary structure 





..................






Template SS confidence 



































   1..... ...10........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions