Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB71
Confidence72.09%DateThu Jan 5 11:14:46 GMT 2012
Rank161Aligned Residues64
% Identity13%Templatec3ojcD_
PDB info PDB header:isomeraseChain: D: PDB Molecule:putative aspartate/glutamate racemase; PDBTitle: crystal structure of a putative asp/glu racemase from yersinia pestis
Resolution1.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   199200.........210.........220.........230.........240.........250.........260.........270........
Predicted Secondary structure 


































Query SS confidence 















































































Query Sequence  QPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDS
Query Conservation   



      

  



 






 

 

     
    
 

   
          











 
 
  
Alig confidence 
































............





.........




.....









Template Conservation       
      
   
   








    ............ 
    ......... 



..... 
  
     
Template Sequence  TAAQLLSNAAISLKHAGAEVIVVCTNTXHKVAD. . . . . . . . . . . . DIEAAC. . . . . . . . . GLPLL. . . . . HIADATAVQI
Template Known Secondary structure  T

SSSGGGGG.....................TS
B
.....
Template Predicted Secondary structure 







............
.........


.....
Template SS confidence 















































































   60.........70.........80.........90.. ...... .100... ......110...
 
   279280........
Predicted Secondary structure 



Query SS confidence 









Query Sequence  VSYGVVKMNI
Query Conservation 
  

 



Alig confidence 









Template Conservation       




Template Sequence  KQQGIDKIGL
Template Known Secondary structure  TT

Template Predicted Secondary structure 



Template SS confidence 









   114.....120...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions